Primary Antibodies

Primary antibodies are immunoglobulins that recognize and bind to a specific antigen of interest with high affinity and specificity to purify, detect, and measure that antigen. Includes antibody pairs for specific biochemical applications.

Search Within Results

4,276 – 4,290 of 1,799,146 results

4,276

Invitrogen™ Axl Recombinant Rat Monoclonal Antibody (MAXL8DS), Alexa Fluor™ Plus 488

Rat Recombinant Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	4°C, store in dark, DO NOT FREEZE!
Target Species	Mouse
Host Species	Rat
Conjugate	Alexa Fluor Plus 488
Applications	Flow Cytometry
Form	Liquid
Gene Accession No.	Q00993
Isotype	IgG2a κ
Concentration	1 mg/mL
Antigen	Axl
Gene Symbols	AXL
Regulatory Status	RUO
Purification Method	Affinity chromatography
Gene Alias	Adhesion-related kinase; AI323647; ARK; AXL; AXL oncogene; AXL receptor tyrosine kinase; AXL transforming sequence/gene; AZF1; JTK11; oncogene AXL; sAXL; soluble AXL; Tyro7; Tyrosine-protein kinase receptor UFO; Ufo; ufo oncogene homolog
Gene	AXL
Product Type	Antibody
Gene ID (Entrez)	26362
Formulation	Proprietary buffer with 0.008% Bromonitrodioxane, 0.008% Methylisothiazolone; pH 6.3-7.3
Classification	Recombinant Monoclonal
Primary or Secondary	Primary
Clone	MAXL8DS

4,277

Invitrogen™ GRP78 Polyclonal Antibody, Alexa Fluor™ 488

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	4°C, store in dark, DO NOT FREEZE!
Target Species	Human,Mouse,Rat
Host Species	Rabbit
Conjugate	Alexa Fluor 488
Applications	Immunocytochemistry
Form	Liquid
Gene Accession No.	P06761, P11021, P20029
Isotype	IgG
Concentration	1 mg/mL
Antigen	GRP78
Gene Symbols	Hspa5
Regulatory Status	RUO
Purification Method	Antigen affinity chromatography
Gene Alias	78 kDa glucose-regulated protein; 78 kDa glucose-regulated protein homolog; 78-kD glucose-regulated protein precursor; AL022860; AU019543; baffled; Binding-immunoglobulin protein; bip; BiP protein; BiP/Grp78; cb865; D2Wsu141e; D2Wsu17e; Endoplasmic reticulum chaperone BiP; endoplasmic reticulum chaperone BiP; 78 kDa glucose-regulated protein; endoplasmic reticulum lumenal Ca(2+)-binding protein grp78; epididymis secretory sperm binding protein Li 89n; fb60h09; fi36d04; FLJ26106; glucose regulated protein, 78 kDa; glucose-regulated protein; glucose-regulated protein, 78kDa; GRP 78; grp78; GRP-78; heat shock 70 kDa protein 5; heat shock 70 kDa protein 5a; heat shock 70kD protein 5; heat shock 70kD protein 5 (glucose-regulated protein, 78kD); heat shock 70kDa protein 5; heat shock 70kDa protein 5 (glucose-regulated protein); heat shock 70kDa protein 5 (glucose-regulated protein, 78kDa); heat shock protein 5; heat shock protein 70 family protein 5; heat shock protein family A (Hsp70) member 5; heat shock protein family A (Hsp70) member 5 L homeolog; heat shock protein family A member 5; heavy-chain binding protein BiP; HEL-S-89n; Hsce70; hsp70; Hsp70 family ATPase KAR2; HSP70 family protein 5; HSPA 5; HSPA5; hspa5.L; hspa5a; I79_019946; immunoglobulin binding protein; immunoglobulin heavy chain-binding protein; Immunoglobulin heavy chain-binding protein homolog; J1248; KAR2; mBiP; MIF2; Sez7; SEZ-7; SSD1; Steroidogenesis-activator polypeptide; wu:fb60h09; wu:fi36d04; XAP-1; XAP-1 antigen; XELAEV_180384511mg; YJL034W; zgc:55994; zgc:77606
Gene	Hspa5
Product Type	Antibody
Gene ID (Entrez)	14828, 25617, 3309
Formulation	PBS with 1mg/mL BSA and 0.05% sodium azide; pH 7.4
Immunogen	Synthetic peptide corresponding to residues C T(643) G E E D T S E K D E L(654) of rat GRP78.
Classification	Polyclonal
Primary or Secondary	Primary

4,278

Invitrogen™ CD32 Monoclonal Antibody (6C4 (CD32)), eFluor™ 450, eBioscience™

Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	4°C, store in dark, DO NOT FREEZE!
Target Species	Human
Host Species	Mouse
Conjugate	eFluor 450
Applications	Flow Cytometry
Form	Liquid
Gene Accession No.	P12318, P31994, P31995
Isotype	IgG1 κ
Concentration	5 μL/Test
Antigen	CD32
Gene Symbols	FCGR2A, FCGR2B, FCGR2C
Regulatory Status	RUO
Purification Method	Affinity chromatography
Gene Alias	CD32; CD32 receptor 2; CD32 receptor 2a; CD32A; CD32B; CD32C; CDW32; Fc fragment of IgG receptor IIa; Fc fragment of IgG receptor IIb; Fc fragment of IgG receptor IIc (gene/pseudogene); Fc fragment of IgG, low affinity II, receptor for (CD32); Fc fragment of IgG, low affinity IIa, receptor (CD32); Fc fragment of IgG, low affinity IIa, receptor for (CD32); Fc fragment of IgG, low affinity IIb, receptor (CD32); Fc fragment of IgG, low affinity IIb, receptor for (CD32); Fc fragment of IgG, low affinity IIc, receptor for (CD32); Fc gamma receptor II; Fc gamma receptor IIa; Fc gamma receptor IIb; Fc gamma receptor IIC; Fc gamma RIIb; FCG2; Fc-gamma receptor II; fc-gamma RII; Fc-gamma RII-a; fc-gamma RII-b; Fc-gamma RII-c; fc-gamma-RIIa; Fc-gamma-RIIb; fc-gamma-RIIc; Fc-gamma-RII-D; FcGR; FCGR2; FCGR2A; FCGR2A1; FCGR2B; FCGR2C; fcRII; fcRII-a; fcRII-b; FCRIIC; FGFR2B; IGFR2; IgG Fc fragment receptor; IgG Fc gamma receptor II; igG Fc receptor II; IgG Fc receptor II-a; igG Fc receptor II-b; IgG Fc receptor II-c; Immunoglobulin G Fc receptor II; immunoglobulin G Fc receptor II-c; low affinity immunoglobulin gamma Fc region receptor II; Low affinity immunoglobulin gamma Fc region receptor II-a; low affinity immunoglobulin gamma Fc region receptor II-b; Low affinity immunoglobulin gamma Fc region receptor II-c; MGC23887; MGC30032; RP11-5K23.6; soluble receptor; boFcRII-2
Gene	FCGR2A
Product Type	Antibody
Gene ID (Entrez)	2212, 2213, 9103
Formulation	PBS with BSA and 0.09% sodium azide; pH 7.2
Classification	Monoclonal
Primary or Secondary	Primary
Clone	6C4 (CD32)

4,279

CD95 (APO-1/Fas) Monoclonal Antibody (EOS9.1), Functional Grade, eBioscience™, Invitrogen™

Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	4°C
Target Species	Human
Host Species	Mouse
Conjugate	Functional Grade
Applications	Flow Cytometry,Functional Assay
Form	Liquid
Isotype	IgM κ
Gene Accession No.	P25445
Concentration	1 mg/mL
Antigen	CD95 (APO-1/Fas)
Gene Symbols	FAS
Regulatory Status	RUO
Purification Method	Affinity chromatography
Gene Alias	AI196731; ALPS1A; APO1; APO-1; Apo1 antigen; Apo-1 antigen; APO-1 cell surface antigen; Apo-1 Fas; apoptosis antigen 1; apoptosis signaling receptor FAS; apoptosis-mediating surface antigen FAS; APT1; CD95; CD95 antigen; FAS; Fas (TNF receptor superfamily member 6); Fas (TNF receptor superfamily member); Fas (TNF receptor superfamily, member 6); Fas AMA; Fas antigen; Fas antigen (ATP1); Fas cell surface death receptor; Fas receptor; FAS1; FASLG receptor; FASTM; lpr; lymphoproliferation; OTTHUMP00000020045; OTTHUMP00000020046; OTTHUMP00000020051; OTTHUMP00000059646; TNF receptor superfamily member 6; TNFR6; Tnfrsf6; tumor necrosis factor receptor superfamily member 6; tumor necrosis factor receptor superfamily member 6; tumor necrosis factor receptor superfamily member 26; Tumor necrosis factor receptor superfamily, member 6
Gene	FAS
Product Type	Antibody
Gene ID (Entrez)	355
Formulation	PBS with no preservative; pH 7.2
Classification	Monoclonal
Primary or Secondary	Primary
Clone	EOS9.1

4,280

Invitrogen™ NTCP Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	-20°C
Target Species	Mouse,Rat
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Flow Cytometry,Immunohistochemistry,Immunohistochemistry (Frozen),Immunohistochemistry (Paraffin),Western Blot
Form	Lyophilized
Gene Accession No.	O08705, P26435
Isotype	IgG
Concentration	500 μg/mL
Antigen	NTCP
Gene Symbols	SLC10A1
Regulatory Status	RUO
Purification Method	Antigen affinity chromatography
Gene Alias	bile acid cotransporting polypeptide; cell growth-inhibiting gene 29 protein; GIG29; growth-inhibiting protein 29; hepatic sodium-dependent bile acid transporter; LOW QUALITY PROTEIN: sodium/bile acid cotransporter; MGC128766 protein; Na(+)/bile acid cotransporter; Na(+)/taurocholate transport protein; Na/taurocholate cotransporting polypeptide; NA-dependent cholate transporting protein; Ntcp; Ntcp1; SBACT; Slc10a1; sodium bile acid cotransporting polypeptide; sodium/bile acid cotransporter; sodium/tauro; sodium/taurocholate cotransporter; sodium/taurocholate cotransporting polypeptide; sodium-dependent bile acid cotransporter; sodium-dependent taurocholate cotransporting polypeptide; sodium-taurocholate cotransporting polypeptide; solute carrier family 10 (sodium/bile acid cotransporter family), member 1; solute carrier family 10 (sodium/bile acid cotransporter), member 1; solute carrier family 10 member 1; solute carrier family 10, member 1
Gene	SLC10A1
Product Type	Antibody
Gene ID (Entrez)	20493, 24777
Formulation	PBS with 4mg trehalose and no preservative
Immunogen	A synthetic peptide corresponding to a sequence at the C-terminus of mouse SLC10A1 (296-336aa EGLLFIIIFRCYLKIKPQKDQTKITYKAAATEDATPAALEK).
Classification	Polyclonal
Primary or Secondary	Primary

4,281

Invitrogen™ CD45R Monoclonal Antibody (RA3-6B2), PE-Cyanine7

Rat Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	4°C, store in dark, DO NOT FREEZE!
Target Species	Feline,Human,Mouse
Host Species	Rat
Conjugate	PE-Cyanine7
Applications	Flow Cytometry
Form	Liquid
Gene Accession No.	P06800, P08575
Isotype	IgG2a κ
Concentration	0.1 mg/mL
Antigen	CD45R
Gene Symbols	PTPRC
Regulatory Status	RUO
Purification Method	Purified
Gene Alias	B220; Cd45; CD45 antigen; CD45R; GP180; Lca; L-CA; leucocyte common antigen; leukocyte common antigen; leukocyte common antigen A; leukocyte common antigen B; loc; LY5; Ly-5; Lymphocyte antigen 5; lymphocyte common antigen; Lyt-4; membrane tyrosine phosphatase; protein tyrosine phosphatase receptor type C; protein tyrosine phosphatase, receptor type C; protein tyrosine phosphatase, receptor type, C; protein tyrosine phosphatase, receptor type, c polypeptide; Protein tyrosine phosphatase, receptor-type, c polypeptide; Ptprc; Receptor-type tyrosine-protein phosphatase C; RT7; T200; T200 glycoprotein; T200 leukocyte common antigen
Gene	PTPRC
Product Type	Antibody
Gene ID (Entrez)	101097123, 19264, 5788
Formulation	PBS with proprietary stabilizer and <0.1% sodium azide; pH 7.1
Immunogen	exon A-specific epitope on CD45 from Abelson murine leukemia virus-induced pre-B cell lymphoma.
Classification	Monoclonal
Primary or Secondary	Primary
Clone	RA3-6B2

4,282

Invitrogen™ PFKL Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species	Human,Mouse
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Immunohistochemistry (Paraffin),Western Blot,Immunocytochemistry
Form	Liquid
Gene Accession No.	P12382, P17858
Isotype	IgG
Concentration	1.23 mg/mL
Antigen	PFKL
Gene Symbols	PFKL
Regulatory Status	RUO
Purification Method	Antigen affinity chromatography
Gene Alias	6-phosphofructokinase type B; 6-phosphofructokinase, liver type; AA407869; ATP-dependent 6-phosphofructokinase, liver type; ATP-dependent 6-phosphofructokinase, liver type {ECO:0000255; ATP-PFK; ATP-PFK {ECO:0000255; EC 2.7.1.11; HAMAP-Rule:MF_03184}; K6PL; liver-type 1-phosphofructokinase; Pfkb; PFK-B; Pfkl; Pfk-l; Phosphofructo-1-kinase isozyme B; phosphofructokinase 1; phosphofructokinase, liver; phosphofructokinase, liver type; phosphofructokinase, liver, B-type; phosphohexokinase; phosphohexokinase {ECO:0000255
Gene	PFKL
Product Type	Antibody
Gene ID (Entrez)	18641, 5211
Formulation	PBS with 20% glycerol and 0.025% ProClin 300; pH 7
Immunogen	Recombinant fragment corresponding to a region within amino acids 428 and 674 of PFKL (Uniprot ID#P17858).
Classification	Polyclonal
Primary or Secondary	Primary

4,283

Invitrogen™ SSEA1 Monoclonal Antibody (MC-480), DyLight™ 488

Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	4°C, do not freeze
Target Species	Human,Mouse
Host Species	Mouse
Conjugate	DyLight 488
Applications	Flow Cytometry,Immunocytochemistry
Form	Liquid
Gene Accession No.	P22083, Q11127
Isotype	IgM
Concentration	1 mg/mL
Antigen	SSEA1
Gene Symbols	FUT4
Regulatory Status	RUO
Purification Method	Affinity chromatography - MBP
Gene Alias	FUTIV; Lewis X; SSEA-1
Gene	FUT4
Product Type	Antibody
Gene ID (Entrez)	14345, 2526
Formulation	PBS with proprietary stabilizer and 0.02% sodium azide
Immunogen	BALB/c mouse immunized with F9 teratocarcinoma stem cells (X-irradiated).
Classification	Monoclonal
Primary or Secondary	Primary
Clone	MC-480

4,284

iNOS Monoclonal Antibody (CXNFT), Alexa Fluor™ 488, eBioscience™, Invitrogen™

Rat Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	4°C, store in dark, DO NOT FREEZE!
Target Species	Mouse
Host Species	Rat
Conjugate	Alexa Fluor 488
Applications	Flow Cytometry,Western Blot,Immunocytochemistry
Form	Liquid
Isotype	IgG2a κ
Gene Accession No.	P29477
Concentration	0.5 mg/mL
Antigen	iNOS
Gene Symbols	Nos2
Regulatory Status	RUO
Purification Method	Affinity chromatography
Gene Alias	Hepatocyte NOS; hepatocytes; HEP-NOS; inducible nitric oxide synthase; inducible NO synthase; Inducible NOS; iNos; i-NOS; Inosl; MAC-NOS; macrophage NOS; nitric oxide synthase 2; nitric oxide synthase 2, inducible; nitric oxide synthase 2, inducible, macrophage; nitric oxide synthase 2A (inducible, hepatocytes); nitric oxide synthase, inducible; nitric oxide synthase, macrophage; nitric oxide synthase-inducible; NOS; NOS type II; NOS, type II; Nos2; Nos-2; Nos2a; NOS-II; OTTMUSP00000000202; peptidyl-cysteine S-nitrosylase NOS2
Gene	Nos2
Product Type	Antibody
Gene ID (Entrez)	18126
Formulation	PBS with 0.09% sodium azide; pH 7.2
Classification	Monoclonal
Primary or Secondary	Primary
Clone	CXNFT

4,285

FOXP3 Monoclonal Antibody (FJK-16s), PE-Cyanine7, eBioscience™, Invitrogen™

Rat Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	4°C, store in dark, DO NOT FREEZE!
Target Species	Bovine,Canine,Feline,Mouse,Pig,Rat
Host Species	Rat
Conjugate	PE-Cyanine7
Applications	Flow Cytometry
Form	Liquid
Isotype	IgG2a κ
Gene Accession No.	Q99JB6
Concentration	0.2 mg/mL
Antigen	FOXP3
Gene Symbols	Foxp3
Regulatory Status	RUO
Purification Method	Affinity chromatography
Gene Alias	AIID; DIETER; forkhead box P3; forkhead box protein P3; Forkhead box protein P3 41 kDa form; Forkhead box protein P3, C-terminally processed; forkhead/winged helix transcription factor 3; Foxp3; FOXP3delta7; immune dysregulation, polyendocrinopathy, enteropathy, X-linked; immunodeficiency, polyendocrinopathy, enteropathy, X-linked; IPEX; JM2; MGC141961; MGC141963; PIDX; regulatory protein Foxp3; RGD1562112; RP23-54C14.1; scurfin; scurfy; sf; XPID
Gene	Foxp3
Product Type	Antibody
Gene ID (Entrez)	100037405, 20371, 317382, 444998, 491876, 506053
Formulation	PBS with 0.09% sodium azide; pH 7.2
Classification	Monoclonal
Primary or Secondary	Primary
Clone	FJK-16s

4,286

Invitrogen™ MBP Polyclonal Antibody

Goat Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species	Human,Mouse,Rat,Bovine,Pig
Host Species	Goat
Conjugate	Unconjugated
Applications	Immunohistochemistry (Paraffin),Western Blot,Immunocytochemistry
Form	Liquid
Gene Accession No.	P02686, P02687, P02688, P04370, P81558
Isotype	IgG
Concentration	1 mg/mL
Antigen	MBP
Gene Symbols	MBP
Regulatory Status	RUO
Purification Method	Affinity chromatography
Gene Alias	20 kDa microtubule-stabilizing protein; C76307; golli mbp; Golli-mbp; Golli-MBP; myelin basic protein; Golli-Mbp; myelin basic protein; myelin basic protein S; Hmbpr; MBP; MBP S; Mbps; MGC99675; microtubule-stabilizing protein; mld; MOBP; Myelin A1 protein; myelin basic protein; myelin basic protein Golli-mbp; myelin basic protein S; myelin deficient; myelin membrane encephalitogenic protein; Myelin P1 protein; myelin-associated oligodendrocyte basic protein; R75289; shi; shiverer; Unknown (protein for IMAGE:7984318); unnamed protein product
Gene	MBP
Product Type	Antibody
Gene ID (Entrez)	17196, 24547, 414286, 4155, 618684
Formulation	PBS with 50% glycerol and 5mM sodium azide
Immunogen	Purified myelin basic protein isolated from bovine brain.
Classification	Polyclonal
Primary or Secondary	Primary

4,287

Invitrogen™ Granzyme B Monoclonal Antibody (N4TL33), PE, eBioscience™

Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	4°C, store in dark, DO NOT FREEZE!
Target Species	Human
Host Species	Mouse
Conjugate	PE
Applications	Flow Cytometry
Form	Liquid
Gene Accession No.	P10144
Isotype	IgG2a κ
Concentration	5 μL/Test
Antigen	Granzyme B
Gene Symbols	GZMB
Regulatory Status	RUO
Purification Method	Affinity chromatography
Gene Alias	AI553453; C11; Cathepsin G-like 1; CCP1; CCP-1/C11; CCPI; CGL1; CGL-1; CSPB; CSP-B; Ctla1; Ctla-1; CTSGL1; cytotoxic cell protease 1; cytotoxic serine protease B; Cytotoxic T lymphocyte associated serine esterase 1; cytotoxic T-lymphocyte proteinase 2; cytotoxic T-lymphocyte-associated serine esterase 1; fragmentin; fragmentin 2; fragmentin-2; GLP I; GLP III; GLP-1; granzyme 2; granzyme B; granzyme B (granzyme 2, cytotoxic T-lymphocyte-associated serine esterase 1); granzyme B(G,H); Granzyme-2; GranzymeB; granzyme-like protein 1; granzyme-like protein I; GRB; GZB; Gzmb; HLP; human lymphocyte protein; Human lymphocyte protein (Hlp); Lymphocyte protease; Natural killer cell protease 1; OTTHUMP00000028189; RNKP-1; SECT; T-cell serine protease 1-3E
Gene	GZMB
Product Type	Antibody
Gene ID (Entrez)	3002
Formulation	PBS with BSA and 0.09% sodium azide; pH 7.2
Classification	Monoclonal
Primary or Secondary	Primary
Clone	N4TL33

4,288

HELIOS Monoclonal Antibody (22F6), Brilliant Ultra Violet™ 563, eBioscience™, Invitrogen™

Armenian Hamster Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	4°C, store in dark, DO NOT FREEZE!
Target Species	Human,Mouse,Canine
Host Species	Armenian Hamster
Conjugate	Brilliant Ultraviolet 563
Applications	Flow Cytometry
Form	Liquid
Isotype	IgG
Gene Accession No.	P81183, Q9UKS7
Concentration	5 μL/Test
Antigen	HELIOS
Gene Symbols	IKZF2
Regulatory Status	RUO
Purification Method	Affinity chromatography
Gene Alias	A730095J18Rik; ANF1A2; Helios; IKAROS family zinc finger 2; IKAROS family zinc finger 2 (Helios); ikaros family zinc finger protein 2; Ikzf2; Zfpn1a2; zinc finger DNA binding protein Helios; zinc finger protein Helios; zinc finger protein, subfamily 1A, 2 (Helios); ZNF1A2; Znfn1a2
Gene	IKZF2
Gene ID (Entrez)	22779, 22807, 488510
Formulation	PBS with BSA and 0.09% sodium azide; pH 7.2
Classification	Monoclonal
Primary or Secondary	Primary
Clone	22F6

4,289

CD1a Monoclonal Antibody (HI149), eFluor™ 450, eBioscience™, Invitrogen™

Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	4°C, store in dark, DO NOT FREEZE!
Target Species	Human
Host Species	Mouse
Conjugate	eFluor 450
Applications	Flow Cytometry
Form	Liquid
Isotype	IgG1 κ
Gene Accession No.	P06126
Concentration	5 μL/Test
Antigen	CD1a
Gene Symbols	CD1A
Regulatory Status	RUO
Purification Method	Affinity chromatography
Gene	CD1A
Product Type	Antibody
Gene ID (Entrez)	909
Classification	Monoclonal
Primary or Secondary	Primary
Clone	HI149

4,290

IRF4 Monoclonal Antibody (3E4), eFluor™ 450, eBioscience™, Invitrogen™

Rat Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	4°C, store in dark, DO NOT FREEZE!
Target Species	Human,Mouse
Host Species	Rat
Conjugate	eFluor 450
Applications	Flow Cytometry
Form	Liquid
Isotype	IgG1 κ
Gene Accession No.	Q15306, Q64287
Concentration	0.2 mg/mL
Antigen	IRF4
Gene Symbols	IRF4
Regulatory Status	RUO
Purification Method	Affinity chromatography
Gene Alias	AI385587; interferon regulatory factor 4; Irf4; IRF-4; LSIRF; Lymphocyte-specific interferon regulatory factor; multiple myeloma oncogene 1; MUM1; NF-EM5; PU.1 interaction partner; Sfpi1/PU.1 interaction partner; SHEP8; Spip; Transcriptional activator PIP
Gene	IRF4
Product Type	Antibody
Gene ID (Entrez)	16364, 3662
Formulation	PBS with 0.09% sodium azide; pH 7.2
Classification	Monoclonal
Primary or Secondary	Primary
Clone	3E4

Primary Antibodies

Filtered Search Results

Narrow Results

Invitrogen™ GRP78 Polyclonal Antibody, Alexa Fluor™ 488 Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ CD32 Monoclonal Antibody (6C4 (CD32)), eFluor™ 450, eBioscience™ Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

CD95 (APO-1/Fas) Monoclonal Antibody (EOS9.1), Functional Grade, eBioscience™, Invitrogen™ Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ NTCP Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ CD45R Monoclonal Antibody (RA3-6B2), PE-Cyanine7 Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ PFKL Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ SSEA1 Monoclonal Antibody (MC-480), DyLight™ 488 Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

iNOS Monoclonal Antibody (CXNFT), Alexa Fluor™ 488, eBioscience™, Invitrogen™ Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

FOXP3 Monoclonal Antibody (FJK-16s), PE-Cyanine7, eBioscience™, Invitrogen™ Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ MBP Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ Granzyme B Monoclonal Antibody (N4TL33), PE, eBioscience™ Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

HELIOS Monoclonal Antibody (22F6), Brilliant Ultra Violet™ 563, eBioscience™, Invitrogen™ Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

CD1a Monoclonal Antibody (HI149), eFluor™ 450, eBioscience™, Invitrogen™ Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

IRF4 Monoclonal Antibody (3E4), eFluor™ 450, eBioscience™, Invitrogen™ Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ GRP78 Polyclonal Antibody, Alexa Fluor™ 488

Invitrogen™ CD32 Monoclonal Antibody (6C4 (CD32)), eFluor™ 450, eBioscience™

CD95 (APO-1/Fas) Monoclonal Antibody (EOS9.1), Functional Grade, eBioscience™, Invitrogen™

Invitrogen™ NTCP Polyclonal Antibody

Invitrogen™ CD45R Monoclonal Antibody (RA3-6B2), PE-Cyanine7

Invitrogen™ PFKL Polyclonal Antibody

Invitrogen™ SSEA1 Monoclonal Antibody (MC-480), DyLight™ 488

iNOS Monoclonal Antibody (CXNFT), Alexa Fluor™ 488, eBioscience™, Invitrogen™

FOXP3 Monoclonal Antibody (FJK-16s), PE-Cyanine7, eBioscience™, Invitrogen™

Invitrogen™ MBP Polyclonal Antibody

Invitrogen™ Granzyme B Monoclonal Antibody (N4TL33), PE, eBioscience™

HELIOS Monoclonal Antibody (22F6), Brilliant Ultra Violet™ 563, eBioscience™, Invitrogen™

CD1a Monoclonal Antibody (HI149), eFluor™ 450, eBioscience™, Invitrogen™

IRF4 Monoclonal Antibody (3E4), eFluor™ 450, eBioscience™, Invitrogen™